DPCstruct | MC28749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 165 ± 30 aa |
| Standard deviation of domain lengths | 29.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0023- PF18074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7J186 | 1-130 | MIQTYQPENFAIVSAAKNDYRNFYRQESAYRRLLHFPPFSHLLSVEITSRTEEGCISMGAFITGRLKNAFPDLFVAGPTPSPISKIK… |
| A0A6G2P7D1 | 204-381 | GYAAALLLDGWAMLGRPDLRAGEEALRRWLAASALVRGQEEGGTVVVVAEPTERAVQALVRWDPAGFARRELADRAELGFPPVSRMA… |
| A0A7W1QD44 | 18-166 | None |
| A0A7V6KW68 | 555-741 | None |
| A0A2V7KMN8 | 864-1062 | None |
| A0A1Q9TET9 | 253-448 | None |
| A0A7V3AEY9 | 769-953 | None |
| A0A0J9T913 | 1-151 | None |
| A0A6M1HU81 | 5-151 | None |
| A0A2M8EHR7 | 284-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.