DPCstruct | MC28747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 15.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4QYU9 | 1-82 | MEVAAALRWLGKASLPLSALAEAAVVRPALDALGLTMDGRPAAASTTRRRRSVFYNVLQYAVELELLDFGPVDKLRVRPSRR |
| A0A327SI61 | 21-124 | RTALFQWAFNTRCRASAPDDIAVVLGWIRRQSPVMEVWEDPEVADDVLRALYHRLDDSVAAASSRMRHRQVLNVAMAYAVRRNILSA… |
| A0A841BZ62 | 118-246 | None |
| A0A7J9VJM4 | 8-102 | None |
| A0A4U0RC38 | 1-123 | None |
| A0A841CGH2 | 91-183 | None |
| A0A399HAX5 | 2-114 | None |
| A0A1C6MSE1 | 4-101 | None |
| A0A6I1YR36 | 6-111 | None |
| A0A4D4LMK9 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.