DPCstruct | MC2874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6N249 | 42-120 | ILNDRNEEKRITEAEKNERVQRQLKTLTDELAQARDEDMKTQNDLIHRENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM |
| A0A183Q000 | 38-116 | AVNNVDEDLRQSKQDTDEDHATRLKLLRQDLSSVRNPNKMQAIDIHYEDIVSKGMDKYRTLRAIREGNTKKRVDQFESM |
| E4YGL7 | 229-298 | None |
| A0A0N4T0I9 | 209-281 | None |
| A0A1I8HTK0 | 212-286 | None |
| A0A7R8H6W0 | 187-275 | None |
| A0A5J4NFI6 | 285-358 | None |
| A0A4Z2G2K6 | 295-378 | None |
| A0A6F9C2Z0 | 290-367 | None |
| A0A3R7ST05 | 111-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.