DPCstruct | MC28738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 161 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3DKY3 | 149-317 | SAKSFFRSFAIIVANLVIGCILATGILYAVYLLPINKIDRNVGKSTLIFYQEGSYPELTGYATSTLDNWTDSVIVLEAASPRVESPI… |
| A0A1G4RUY2 | 3-172 | IVKKIGMYVPVFLLTMCGLAAMLVLSARIPRTALQDHMRDSAEYLSRYDKSYRLIKGADICRLDRNADAIWLSIAYGYDSKKPVSSV… |
| A0A3D5M1B0 | 1-180 | None |
| R9IU72 | 8-155 | None |
| A0A416G074 | 3-144 | None |
| A0A417T9R6 | 1-160 | None |
| A0A316PV56 | 10-170 | None |
| R5PPP6 | 1-165 | None |
| A0A845R1K2 | 157-327 | None |
| A0A1C5MV67 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.