DPCstruct | MC28736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 77.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9V964 | 26-72 | LICAKCAREFTYKNQRLLTVHHKDGNHLNNPPDGSNWENLCVYCHED |
| A0A8A5VYK2 | 1-58 | YREKALKLYPWVCGRCAREFVYSNLRELTVHHKDHDHTNNPEDGSNWELLCLYCHDHE |
| A0A8B6QKY5 | 1-44 | None |
| W9T142 | 17-75 | None |
| A0A3M5ALU6 | 96-154 | None |
| A0A8A5VS69 | 2-50 | None |
| A0A1V5H5J4 | 221-279 | None |
| A0A3N5RRN0 | 107-165 | None |
| A0A8A5VB05 | 7-65 | None |
| A0A0F2P9S2 | 37-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.