DPCstruct | MC28729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 188 ± 35 aa |
| Standard deviation of domain lengths | 34.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0E8F1 | 28-188 | LSEPYGKNFDNEFKPYYSPKQMLKMGVFEGKYLNDCVNEFPIEWYDESKDKRSLVADPKLNYFGVKSRQSLTTWKKNGWIPVCKGDY… |
| A0A553PTI0 | 20-224 | VKQGVSTTAQADRTAPPPQRNARGQLEFEGFPMFRPNRTPAQVLQAGSFGGTYFRPIYSSVTGEKYGASVWQELPDHWLTGLNVKTQ… |
| A0A7K3ZHC4 | 117-282 | None |
| A0A7S0ITN7 | 3-127 | None |
| A0A4Q4XP86 | 9-210 | None |
| A0A7S3BA87 | 194-345 | None |
| A0A7S0DLI0 | 10-182 | None |
| A0A813F737 | 22-235 | None |
| A0A2P6NIS9 | 157-368 | None |
| A0A645C663 | 2-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.