DPCstruct | MC28723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1178 |
|---|---|
| Mean domain length (aa) | 144 ± 29 aa |
| Standard deviation of domain lengths | 28.90 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 87.49 |
| Assigned Pfam label(s) | CL0323- CL0531- CL0063- CL0099- CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4RN08 | 6-131 | GEVGAGLPDFLRPTHFARVESIPLTVNGKADTKALPEARPLGALTTAGERGPETGTETVVCEFFAEALDLDDDEVSAVSDFVSLGGH… |
| A0A538TP98 | 16-144 | LPQVVVSTQDLDELVAQATSSSVAEFLEGVGRATPQQDGEGTDVSALESDTQRRVAALWSRLLGVGRIGRQDNFFDLGGNSLLAIQL… |
| A0A0P9JG48 | 5-126 | None |
| A0A5N6WB47 | 24-136 | None |
| A0A818ZT98 | 2-128 | None |
| A0A7Z0TKL2 | 81-218 | None |
| W4QMX0 | 18-175 | None |
| A0A6P1ALH0 | 862-965 | None |
| A0A7R9A7W3 | 33-194 | None |
| A0A7R9A2N1 | 112-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.