DPCstruct | MC28722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378IYC5 | 7-94 | RIDLPELADELMMNIDDLFPILETLEILGFAKVSDGDIQLSELGKQFSEADLQERKQLFARRLLEKVPLARYIRRVLDEKIGHRVSEE |
| A0A259UHS6 | 1-108 | MLESREIPQANSLRDVITAVFAVANGAKTYQQIAQAIGKGERQGRYYRLAAEQIGLITPHNTNHSMVTPLGQEFISLSPEQREVLLA… |
| A0A455ZED3 | 5-99 | None |
| A0A842UMZ2 | 1-115 | None |
| A0A7C5LN97 | 15-127 | None |
| A0A2Z3GMC0 | 1-104 | None |
| A0A3R7D365 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.