DPCstruct | MC2872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 153 ± 9 aa |
| Standard deviation of domain lengths | 8.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078G6U0 | 60-202 | SAAMLTPLLESQRLCCRIFFSLPECFKGHMNEWMGVFNKCLSCNYPSLESTADGLELVDDLRCAVCDNINLYMDKYEEEFQRFVEGF… |
| A0A183PXS3 | 1-171 | LVIGANRISDASRLTTVLQCLLLVCKIFLSLNCQDLPEFFEDNMQDWMTFFRSLLQLNASTLNLTNGTNENNNATVLIEQIKSQICD… |
| A0A820V208 | 207-362 | None |
| A0A813K7F0 | 994-1145 | None |
| A0A822DZ69 | 1-141 | None |
| G7KL09 | 213-361 | None |
| A0A822BX00 | 28-187 | None |
| A0A7C8V8S5 | 466-616 | None |
| A0A3P6T0B4 | 12-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.