DPCstruct | MC28717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 3 aa |
| Standard deviation of domain lengths | 2.90 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179BU59 | 7-93 | NLNFRIAFDYTGEMHKLWMAASFSFGIPTSFVVDRDGHIAFIGIPMELDDVLPKVIDGSWRTSAEAKKADKERIAEGETYAAEIAFR |
| A0A0A3XMR5 | 3-89 | QSDRRIGVDFTREMENLWLHPSRCVGIPTPFVVDRDGRIAFVGLTMQLDDVLPKVLSGSWRISDEAKAAETERIARDKRIRGETARK |
| A0A8B0I065 | 1-80 | None |
| X6EQ10 | 49-133 | None |
| X6BFT2 | 47-133 | None |
| A0A7Y3WPJ8 | 103-180 | None |
| A0A8B3KYU6 | 1-86 | None |
| H0G565 | 47-131 | None |
| A0A527HPK5 | 21-105 | None |
| A0A5D3KG75 | 7-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.