DPCstruct | MC28716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 504 ± 68 aa |
| Standard deviation of domain lengths | 67.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2E767 | 168-647 | IPSILIGVIPFIPFSLAVLGITLYRLPINVYKTIKISIFTVALKWDLKIIAIITLPFVHALFPLLSFLGALVGSFFYFIIRTWSNIC… |
| A0A7I8J304 | 50-525 | VILGLWPAHAFWTYYSIARSKQLGPVLKIILCIGVTSLLILWPLVGIVGSIVGGAGYGFFAPLMATFEAVGEGRSDKFTHCITDGTW… |
| A0A067JJI9 | 7-495 | None |
| A0A1E5VNK5 | 37-573 | None |
| A0A0G4G913 | 9-640 | None |
| V4KZ51 | 1-438 | None |
| A0A2J6JY95 | 7-572 | None |
| A0A1Q9CZF2 | 196-572 | None |
| A0A834ZJX4 | 582-1110 | None |
| A0A812LI23 | 20-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.