DPCstruct | MC28715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 184 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8IYF1 | 41-233 | CEGDGCVAREPWPVHHVRHRGNLRCLCTSCVLGCHRESFCSHCFELLDGGGVGGRTSALVHCSECSSVCHAACLPDAREAGGYVCPC… |
| A0A7J7NJK2 | 1-173 | MKRELPSDCNGCDTQERWLLHDIRERSEYRRLCTSCVLKVHAGLFCPNCFEVYERSQLPIDKLVCARCPSVSHANCVAKDSQLNWVC… |
| A0A6P4CAH2 | 9-178 | None |
| A0A2I0X0M3 | 16-228 | None |
| A0A5C7IQX3 | 3-199 | None |
| A0A4Y7IIS2 | 2-201 | None |
| B9RFQ8 | 5-195 | None |
| A0A6I9U2Q3 | 1-198 | None |
| A0A2P6R7V3 | 41-254 | None |
| A0A5E4FKM2 | 5-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.