DPCstruct | MC28714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 16.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 63.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 50.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5EKA1 | 39-131 | KMQTASRRIKRKWQSREERKIDREFDVVLIPSDGGCLSGSESDSSDWSIGWTEPLAPSFQTNDEMDSSFAVLVPCYGNKSRGFLEQW… |
| A0A7I8IIX2 | 20-153 | QGKGAKMRSARPRRKWQSREERWRKVDREFDVVLVPSDGGGCLSGSDSDDSDWSIGWLEPHAPDFFSDGGGYESEVETSFAVLVPCY… |
| A0A443NFP8 | 86-207 | None |
| A0A2I0K1V6 | 1-126 | None |
| A0A833V9C8 | 43-156 | None |
| A0A7J9IMR5 | 42-145 | None |
| A0A843UJ33 | 225-350 | None |
| A0A835RKK4 | 1-116 | None |
| A9T7X7 | 142-263 | None |
| A0A830C0G8 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.