DPCstruct | MC28712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 193 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6I978 | 25-205 | QAPASANAEKQPASQTPSDSSVSLLARQLGASATQAQIRDAALDPQSLGQKASQVLTELSGRVGGPDSGAFEGMPRDQLALITYAEH… |
| A0A3M4BJR3 | 10-179 | ARAQARDSSLDFKSLRSLANSISDKIAGNSYHANRKLHDAEIPDTDDPALLERAVQATSFNNGAGKNPFAGLSQDQLRLIIYDEGGD… |
| A0A6B9D1K7 | 256-461 | None |
| A0A6B9D2G1 | 141-365 | None |
| A0A837VY38 | 46-239 | None |
| A0A6M3ZLI3 | 57-260 | None |
| A0A2N7U0L6 | 5-236 | None |
| A0A1G8G863 | 54-235 | None |
| A0A7L6CRW4 | 6-161 | None |
| A0A2L1HQH9 | 44-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.