DPCstruct | MC28711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08894 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8FA22 | 14-105 | ADLEGGQSVFYYSGKVYGFVPGERRTELFDIEGFTIVRLEETEEGYRLLGKEAAFLKNPLTGEILSRWRNPYINNRELPVIHIWNNP… |
| A0A1G8IJE1 | 33-126 | TLDGRAVLYHWSGRVWSRVEGETDRLLFRVEGMNIRQSGSLQNRERGAGFRQVSRELMLYLDPLSGEPLHDWRNPWTGEEVAVMHVA… |
| A0A3B7DYG5 | 61-156 | None |
| A0A552U8B2 | 94-195 | None |
| A0A255Z9E3 | 5-95 | None |
| A0A0B7FP42 | 427-540 | None |
| A0A3M1RU17 | 298-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.