DPCstruct | MC28710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0H4J9 | 42-143 | WKKRAKKTTDIDRTLGLTFGLQLRMIGGNSADKVSAILDKYPTCHALNQAYEGCWCEEQEKRLLADLRFGTSNRTLGVSQSEKIRNF… |
| A0A6L2PAN9 | 297-375 | TKALSVRDLFLKQLVQLHGLSVQKAQAIVERYHTPRVLMAAYQAEGSAGEKLLANIRYGSLNRLIGPVISRTVYQFYTK |
| A0A6V7TYT4 | 662-752 | None |
| A0A4Y7LQH7 | 421-504 | None |
| A0A0V0QPC8 | 250-344 | None |
| J3JUY5 | 126-210 | None |
| A0A7R9A390 | 674-761 | None |
| A0A482V8G2 | 112-195 | None |
| A0A1A6AFS8 | 780-863 | None |
| K1Q5D2 | 77-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.