DPCstruct | MC28709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0H1H7 | 2-102 | TLGRVGLVCPEIVAKHLHHFAKQWCKNLLHFHDSDEREHAFRGLCSVIHKNPRGIVEAIPELVDALARYYNPSQQMALVFHGILAGL… |
| A0A814C8T0 | 118-234 | TIGRLGLVCPNDVSSQLQRFIRPWCIALRNIRDNDEKDSAFRGICNMIILNPLAVTNEFIYVCDAIASWEKPPIELHAKFRDILQTF… |
| A0A2A6D398 | 1122-1238 | None |
| A0A3P7PAL4 | 10-123 | None |
| A0A7J7KZB1 | 569-683 | None |
| A0A2H2JHT2 | 10-135 | None |
| A0A4W2F3J8 | 981-1097 | None |
| A0A812RRR9 | 891-1009 | None |
| A0A0A9KE30 | 1-101 | None |
| A0A4Y7K1S4 | 936-1044 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.