DPCstruct | MC28705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J1GCQ7 | 42-104 | KYTCETILETLKAMNFAEIQEQGFMPLYKRQKITDDLHNACNFRTDYQFITKSQMKTIQKKSK |
| A0A7X5L4E1 | 1-66 | AFTCETILDKLKTINFADIQEQGFIPLYTRDKLTDALHEICGFDTDFKFITKSHMKTIQKKSKGRK |
| A0A1Y4Q1S1 | 13-75 | None |
| A0A383TEV1 | 4-66 | None |
| V2Y8J4 | 1-50 | None |
| A0A1H3WA18 | 93-157 | None |
| A0A662ZNI9 | 13-76 | None |
| R5CKG1 | 86-150 | None |
| A0A359MS26 | 8-69 | None |
| A0A0D0SJ65 | 204-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.