DPCstruct | MC28703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6BBP7 | 3-68 | MNFLVNTSPFAGKVGKFVTSRNIRERLEKELEVNVGLKVEPLENSSVEGFKVLGRGELHLSVLIES |
| A0A1Q3ATK1 | 1-64 | MAFSINTSPFVGREGKYVTSRILRDQLSRELERNLAMRVEDGETTDTFVVIGRGTLHITILIEN |
| A0A813AJN3 | 644-706 | None |
| A0A378B6Z4 | 102-173 | None |
| A0A1Q9CA85 | 889-953 | None |
| A0A3A1VV49 | 161-223 | None |
| A0A800DVC0 | 103-172 | None |
| A0A6V7NYV0 | 772-843 | None |
| A0A7Y5GAN8 | 167-238 | None |
| A0A7J0FHR1 | 352-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.