DPCstruct | MC28702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S0ET34 | 385-465 | ARLRASVAALGYPVDRLYIILTQMVSLVRDGEAIIGGKRKGAIIELKEDLVDEIGRDAARFYFLLNSYETPATVDVELAKR |
| A0A2S6BBC8 | 5-82 | RAGLQALDAGIPQGWPEYVLHQMVTVMRSGEEVKLSKRAGSYLTLRDLIDEAGRDAVRWFLIARKPDSQLTFDIDLAR |
| A0A0F3GKP7 | 1-94 | None |
| A0A538CAT8 | 652-727 | None |
| A0A651HTR5 | 339-418 | None |
| A0A6N6XP02 | 148-223 | None |
| A0A2P7P344 | 27-104 | None |
| X1X198 | 380-455 | None |
| K0YJW9 | 540-614 | None |
| A0A645B994 | 111-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.