DPCstruct | MC28700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6BAK9 | 2-81 | SNQLIGVAASIELLHMASLIHDDIIDDSPLRRGQKTVQSRYGKDVAVYAGDYLFTSFFDLLINHMQGTPYLKRNSQVMKQ |
| A0A1S3JZZ1 | 170-259 | SQQKIGMVAEMIHTASLVHDDVIDASETRRGKPSVFKLWGQRKAILTGDFILSVSSQVLARIGNKEVVGVMSLILDDLVRGEFMQLG… |
| E1ZJL6 | 189-277 | None |
| A0A4U6VN21 | 3-83 | None |
| A0A812WGK8 | 1035-1128 | None |
| A0A0N1HD11 | 480-566 | None |
| R7W564 | 140-226 | None |
| A0A1S3INJ2 | 170-264 | None |
| D7KEL3 | 614-697 | None |
| A0A6D2HY35 | 139-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.