DPCstruct | MC2870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 163 ± 26 aa |
| Standard deviation of domain lengths | 26.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JHT5 | 63-202 | EDEEETEDGDKPKKKKSRRDISSLRKSKNDPNAPSLTRIPLPELRDIDKQEKVLIFKDSMKRANLGPNSPPSICFYTFLNSFAGVCS… |
| A0A183PVX6 | 1-177 | MDTDPSFNDIDGSNVDNNEDNGDQSVAKKKKRRDGMTSGSGHPGRPSLSKDVSKSDSNSPALDRIPLPKLRESYIESKQALSREIST… |
| A0A654I5B6 | 48-232 | None |
| A0A1I8GVK5 | 205-402 | None |
| A0A0X3Q1F4 | 144-342 | None |
| A0A0R3Q8F0 | 154-285 | None |
| V5GLZ5 | 1-162 | None |
| A0A7J7TV09 | 181-305 | None |
| G5CAJ0 | 74-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.