DPCstruct | MC287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4ZFK7 | 1-81 | MPSKLDLIRALLLSDWDPIGVSGCEGAENEYDRYALQVFNMLEDGAGAESIASYLTGVVTDRMSLAGRPEADHRIAARVLM |
| A0A2V7CFP2 | 22-109 | MNEQRERARRYNDAICPILLRDWDPIGVADIPEAHDEYNMYADGVAGILMRGEPKQKLVEYLWTIETENMGLDGNRTRVESAAIRLLQ |
| A0A3N4N6Q9 | 3-92 | None |
| A0A2V6LR55 | 54-133 | None |
| A0A5J6MKH9 | 103-197 | None |
| A0A4V6N681 | 133-214 | None |
| A0A1E8FA52 | 1-99 | None |
| A0A3A8E3N3 | 6-95 | None |
| A0A4S1MFF5 | 49-132 | None |
| A0A2S7IFB4 | 21-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.