DPCstruct | MC28696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.93 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3G7R3 | 25-145 | YQSGGGQRGGQSAPVGQPAAGTMQRDQLRTQDRTTLKDRSQIYGSQLMTPAERRAYRDQMRSLKTAQEREALRKQHHEQMQKRAAER… |
| H1G3S6 | 1-109 | MNKALIFGFAVALGLLPALGAAQAMEEEKTIYGSQLMTQEERDEYRARMRAATTPEEKAQIREEHHARMKARGEEMGVELPDEPPAR… |
| A0A4R8IFK3 | 1-109 | None |
| A0A7C3CSH2 | 1-93 | None |
| D5CSY6 | 9-92 | None |
| A0A2E0LJM4 | 1-98 | None |
| A0A1I2U875 | 1-143 | None |
| A0A1V3NNS5 | 1-114 | None |
| A0A4R3XS38 | 1-133 | None |
| D5MM50 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.