DPCstruct | MC28693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 14.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4VFH7 | 2-100 | CCRAADVLFDSFASEGRINVNQFFEAIWSSGLHRSDPRLRECFFHLRKLQDVEGSVDRNAFHRCVTGFVSLILKALQGRFVIPDFST… |
| A0A6V7V5C9 | 38-156 | FPRRISFHTLEQYSPLTEHHRKLSFTTALQKTKQGLGNLFADDEQSPEDLIHNLFRVPNKSDAYIGKLIIVLKNHGLQKNDPRFAPM… |
| S4R6V8 | 5-107 | None |
| S4RQ45 | 1-96 | None |
| A0A7R9DFQ0 | 80-185 | None |
| A0A4U8URB7 | 1-123 | None |
| J9EGM5 | 11-127 | None |
| A0A183U0W0 | 1-131 | None |
| A0A2G9UX28 | 37-160 | None |
| A0A672YKK2 | 4-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.