DPCstruct | MC28686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7UK11 | 1-93 | MSLNYIKDPASQVPTLSTGSSGVDSIVRYYQNGTEEVKNLLKNECCVIYECSYCRALFRSIINFIAHKRTICRSLQSHIQAEQLSDV… |
| A0A1I7SMJ3 | 1-85 | MPVDPDGQNGLLDVLKFYEDGNPEVKLLLENECNVLYECRVCQKVFRTIISLVSHKRTVCKDAFNNEELIEKNEFLNKLQAELKK |
| A0A670JC04 | 3-120 | None |
| A0A151PEP3 | 22-125 | None |
| A0A5N5NGL1 | 41-138 | None |
| A0A0N4VHN4 | 1-104 | None |
| A0A0N4UWZ4 | 1-80 | None |
| W2SUJ1 | 1-98 | None |
| A0A4Z2BJF3 | 104-233 | None |
| A0A3Q3VMP6 | 50-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.