DPCstruct | MC28683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 211 ± 34 aa |
| Standard deviation of domain lengths | 34.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5QCH3 | 2-132 | APHEMGAAYGPRSPIARFLAHAGKILSIGAGPDAVTALHYAEAVARIEGKRRVTYSMPLLREGKRVWVTTSDWDSNGILDEYAAPDG… |
| A0A316S2H9 | 412-635 | CVVMHVSLKSIGKIDGGAEQLLAASTDYLKNGLFIVPTHTWANVNRDTPLYNVLETVPCVGAFAITCARVANESPNAIRSLHPTHSA… |
| A0A559VDL2 | 755-985 | None |
| A0A4D4MRW4 | 1-154 | None |
| A0A543EU55 | 157-400 | None |
| A0A066YSD5 | 488-735 | None |
| A0A6I5VKC9 | 88-347 | None |
| A0A7W8FY82 | 6-201 | None |
| A0A1V5ZPI0 | 156-314 | None |
| A0A1G1A4K9 | 100-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.