DPCstruct | MC28680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 196 ± 29 aa |
| Standard deviation of domain lengths | 29.19 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6EQY8 | 6-204 | KESKMVEVIAYLYIMLPFLIFAVGWMGKRFWIPILFVLIFSFYKICKEMEKSWIPELHKENLLKIVFIITVIGVWVYYSGIGRLVFQ… |
| A0A316PNZ2 | 1-253 | MVCCILTEGFLPAEDIAVGDGQMREASFSRKNSVRFSYAKLRFAAVLYAAVPVAVFLLGWLKPWWGVPAAALLAAGVLCLRPGRKGS… |
| A0A1H6M9U0 | 19-176 | None |
| A0A6G9AU25 | 1-216 | None |
| A0A521T1X6 | 1-206 | None |
| A0A2N5RSB2 | 190-361 | None |
| A0A3D2MBZ8 | 199-362 | None |
| A0A2N1KIQ7 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.