DPCstruct | MC2868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 341 ± 50 aa |
| Standard deviation of domain lengths | 49.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811WBW4 | 19-303 | RRPASRPSPGATCSIDQRSEQSKALQHSTHTLIFFGGIESMLSRLAAVQRVGAARALCSTLLRLLGLCTRVRRCVRVLTRADTRALP… |
| A0A183PUU4 | 1-369 | LIDFICDSNNLTTDMRLEIVCEGQILMPQLRLHDVYTQIWCANRNNVNKPMRLRYRIPGLEADNLPYVENLSSEQIPPERYSHLSVL… |
| A0A2I0T8B4 | 49-400 | None |
| A0A061RVU1 | 17-461 | None |
| A0A836AXE9 | 1-300 | None |
| A0A815Z113 | 7-324 | None |
| A0A540L6A3 | 1-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.