DPCstruct | MC28675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 317 |
|---|---|
| Mean domain length (aa) | 141 ± 27 aa |
| Standard deviation of domain lengths | 26.84 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | CL0305- CL0031- PF00590- PF21234- CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9JBV1 | 2-99 | VCLGNICRSPLAHGIMEFMVKENGLDWEIDSAGTGDWHVGHAPDKRSVQVAKDRGIDISGQRAQLFDPAFFSSYDRILVMDRQNYND… |
| A0A413DE17 | 15-168 | KGKHTVLFICLGNICRSPAAEGIMKSLVEKAGLQDEFEIDSAGIGGWHVGQLPDSRMRKCGAEHGYNFNSHARQFQKSDFARFETIV… |
| A0A2R6CYM3 | 2-118 | None |
| A0A1B0C2K5 | 71-185 | None |
| A0A354SBF7 | 4-169 | None |
| D6T0J2 | 5-133 | None |
| A0A2V9TFL1 | 229-382 | None |
| A0A6J7UUF1 | 2-128 | None |
| A0A3D1F993 | 2-93 | None |
| A0A259ME25 | 36-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.