DPCstruct | MC28674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 136 ± 13 aa |
| Standard deviation of domain lengths | 13.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8UUN5 | 4-126 | GIAKKTDPALWEKCKVLACKEGKMCKHSARKMQWAVQCYKSKGGRYVGKKDSSNKLHQWTKQKWRTASGKKSKGRLRYLPDKVWDAL… |
| A0A2D9C9R4 | 2-129 | AYTKPSLREGIKKKVMAGTKGGKAGQWSARKAQLVAQEYKSKGGGYSGGKTSGQKSLSKWGKEDWGTKSGKPSTQGKKATGERYLPK… |
| A0A6C0C1I6 | 1-141 | None |
| A0A6J4R853 | 63-203 | None |
| A0A6C0H7B1 | 1-136 | None |
| A0A0A2JAV0 | 4-173 | None |
| A0A3N4M1F8 | 37-191 | None |
| A0A2E7W8W3 | 485-628 | None |
| A0A285R0U7 | 1-134 | None |
| A0A6J4Q240 | 9-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.