DPCstruct | MC28670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.25 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF03477- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377M592 | 2-59 | QDEMYMARAMKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGFHYRAGEPHAEVHALRMA |
| A0A068NH94 | 1-63 | MTDQEYMRIALQLAEGTSGQTSPNPMVGAVVVKDGNIVGMGAHLRAGEEHAEVHALHMAGEKQ |
| A0A7J7IKR5 | 34-93 | None |
| A0A379FJG8 | 14-74 | None |
| A0A7C7T2W3 | 5-65 | None |
| A0A388KS05 | 695-755 | None |
| A0A5J4Z2J9 | 309-371 | None |
| A0A7J6LA32 | 21-80 | None |
| A0A6G1F172 | 45-100 | None |
| A0A7J0G7V1 | 82-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.