DPCstruct | MC2867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 111 ± 13 aa |
| Standard deviation of domain lengths | 12.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W8BU82 | 177-280 | HVVEHMWHAAEAYHFMMLAQRQLRFGIVHNAVVTALRLRDYDDILPAEDVYNILALASCADRSFGICSKAFTKLESLESIPEHRVQK… |
| A0A484BZQ1 | 772-875 | ACIERIWHCAEGYHYMLLAQRQLRFGIMHSAVITSLRLRDYDDVLPVEDIYSLLALASCADRSFDTCSRAFMKLESLESLPEKMQQE… |
| A0A0K2VJ16 | 2-117 | None |
| C1MKL3 | 386-480 | None |
| A0A444SDS5 | 439-557 | None |
| A0A2H2IQW8 | 592-695 | None |
| A0A7S0THY4 | 1-125 | None |
| A0A6L5D3K8 | 837-938 | None |
| A0A812SPJ7 | 587-709 | None |
| A0A4V6A376 | 182-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.