DPCstruct | MC28665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 24.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11655 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0BCL5 | 10-186 | LSSLFSGPLIAAIDASVEAQTESVALLREYGYDEDGQLVTVTFGYTTTESDPAGGTRRVAREIEIPLLLFLSLPNLVIHQIEEEFSA… |
| A0A7W8JND2 | 2-126 | TTCALDALIFALQDAVIGANDSIRRRREAQLARGGMDDSDHVALRVQIPQSPAQDAPCTPVTIALSEFRDRRTPHIAMMSVEFDCRV… |
| A0A135IA28 | 1-204 | None |
| A0A2D9RZU1 | 15-229 | None |
| A0A377M5Z2 | 3-152 | None |
| A0A653S9R0 | 12-193 | None |
| A0A1E9IRF7 | 18-175 | None |
| A0A522RZU9 | 3-182 | None |
| R6F6A1 | 14-167 | None |
| A0A2A4IQE0 | 9-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.