DPCstruct | MC28664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 127 ± 36 aa |
| Standard deviation of domain lengths | 35.96 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133Z1N6 | 1-106 | MRLSTIKNRPTTAPLPDDAIPANAAAIQDDEAGQLNLAYTGSDSTPAAFAVATRRVFAQQYVKTLNTNMTVDVKSPVSGRNIAMNCR… |
| A0A7I8AJI9 | 1-118 | MLTTTVTTSAPNPVPPDAQLGDSVNLEVSRATVCIYGDGYGTTTWLAGTDTSCEFVVAVHQKLVTGVNATTEDIRDFLPMDINVTSP… |
| A0A1A2RH06 | 12-117 | None |
| A0A170S626 | 8-86 | None |
| A0A133Z2M3 | 50-222 | None |
| A0A0M2XQI9 | 89-244 | None |
| A0A7Z0INY8 | 50-170 | None |
| S3X1N6 | 548-705 | None |
| A0A161XAJ7 | 465-585 | None |
| A0A260EDM4 | 104-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.