DPCstruct | MC28663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TK76 | 5-130 | QIFKLNFNFIFYNLVIGTLYCAKSNYEFGISRIVRALEPCERKLGVDTWFYSKRCLASLMENIAKCVIVIRDDVLIECLQFLEACEA… |
| A0A444UPM9 | 35-170 | AFNLKAATKYQLKICMSINYFHVRTQYCAKGNYDFGISQVIKSLEPYNKKLVTDTWYYAKRCFLSLLENMLKHMIMLRGCIVQECIQ… |
| A0A164VEH6 | 963-1106 | None |
| K0R3B9 | 1127-1252 | None |
| A0A448WY83 | 77-210 | None |
| A0A6P3DYD3 | 125-279 | None |
| F1LDJ6 | 21-149 | None |
| A0A6A0A7E1 | 8-129 | None |
| A0A1I7XI89 | 287-398 | None |
| A0A182SNK9 | 9-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.