DPCstruct | MC28661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444ULF4 | 147-278 | MIGRELFSRFPALYPFLLRQLETVASTVDGDSGVLKLHPCLFLLLLILGRLYPSPMDGTSSTLSLAPFVPFIIRCGRSPVWRSREMA… |
| H3DEK2 | 120-252 | MSPPAFFHHYPGLQPFLLAELSGAAQELQDPSNEAKLHLQPSLFPVLTLLAQLQPGVQDATATLSSFLPPLLQLSSSPIYNVRVMAS… |
| A0A835GFD0 | 1-128 | None |
| F6YB51 | 132-253 | None |
| Q553Q9 | 1409-1564 | None |
| E2B2U2 | 465-594 | None |
| A0A6P4E0Q0 | 1-119 | None |
| A0A7F8RM29 | 1-135 | None |
| A0A2R7X1Y4 | 27-148 | None |
| A0A811WUQ5 | 381-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.