DPCstruct | MC28659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 104 ± 21 aa |
| Standard deviation of domain lengths | 20.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7F7C1 | 1-101 | MLQQILIDMYIEPDLLAELNEEQKQVLFFKMREEQIRRWKERETQLEKQEAAHAKAKKVSGKSVSWMKGLDDDVWVWVMGEHQNDKP… |
| A0A444UI26 | 1-96 | MLQQILKEMYIDPDVLEALNEEQKKILFLKMRQEQVRRWTEREENFKKERECLNSAKPKQASPKSVSWLLGNDGDVHVCVIGEAAGA… |
| A0A6P7G584 | 1-110 | None |
| A0A5E4BCA0 | 1-84 | None |
| A0A6P8FQH6 | 1-91 | None |
| A0A3Q0KMW1 | 4-99 | None |
| A0A044T450 | 3-119 | None |
| A0A016U4Z6 | 3-142 | None |
| A0A553MZ74 | 39-121 | None |
| A0A3Q3X150 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.