DPCstruct | MC28657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 402 ± 44 aa |
| Standard deviation of domain lengths | 43.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8E6W1 | 35-446 | LVEEVEKIVSHFKNKWLKDATDDHVDSWIDLIALAKEHAGMPKCKTVEEFGQELIKIRKHEAMSENKILLNDMLKIAERAKMFDEMI… |
| A0A444UH38 | 5-400 | YSSLRTEVHSFERHVQDCKGAFDLDTLKSVLALLTEGHHGEIESLDTIQHLARAQKSTEQSVVKLTFNDRSADIDGYISWFFSYLGH… |
| A0A6J0TNN5 | 5-413 | None |
| A0A6P4XST4 | 29-379 | None |
| A0A7J7JIK3 | 2-390 | None |
| A0A7J7JCY8 | 2-310 | None |
| A0A7I8VVY4 | 2-444 | None |
| V4B687 | 53-449 | None |
| C3ZPJ3 | 10-497 | None |
| R7UAD9 | 532-954 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.