DPCstruct | MC28656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3G7M2 | 60-134 | LATNLRKMEDHGAAITFEFFHYKANKRKKSCRCWALLEMDEIKDGPVILELYQKPMDPKRKRIHLFTEKELYLQL |
| A8IL88 | 77-152 | IQTPLNSLSDKAAIFFEFRHFKAKKNKKSVKAYAFMEMDEIKSGPVTLEVYKKPADYKRSKKPGLLSVKPLYLHLD |
| A0A643CES3 | 1-83 | None |
| A0A813JSH6 | 584-655 | None |
| A0A662YB62 | 78-151 | None |
| A0A2T7NXS3 | 171-245 | None |
| A0A388K1E0 | 408-490 | None |
| A0A7S0WCX3 | 26-108 | None |
| A0A7S2E3C9 | 75-146 | None |
| R7V203 | 90-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.