DPCstruct | MC28653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C921 | 6-147 | ILRLREPIYETMCRCLLQNGYHKAFSEMFHLYEKQNEDRRIAGPDSPLWFIPPIAEQPEKIKLLAHHLSQAEKASRRRDHHTLFTSY… |
| A0A444U7C3 | 2-126 | LREGYHKSFSELFALIQKWNTSREAAGPGSAIWQEEPLEKQPDKLDQLQHFLTRAEAAQRAGRYEEMYTNQLSLANYFNNSGDKWLS… |
| A0A448WIP2 | 2-129 | None |
| A0A6G0HJP6 | 22-158 | None |
| A0A5A9MYR7 | 20-148 | None |
| A0A820KYB0 | 1-167 | None |
| A0A556U082 | 21-158 | None |
| A0A822CQA6 | 1-124 | None |
| A0A3B4WG67 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.