DPCstruct | MC28650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.12 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0111- CL0509- PF01125- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444TYQ0 | 1-124 | MPKVKRSRKPPPDGWELIEPTLDELDQKMREAETDPHEGKRKVESLWPIFRLHHQRSRYIFDLFYKRKAISRELYEYCIKEGYADKN… |
| A0A0R3W2Q3 | 2-112 | IEPTIDELNRKMREAETDPHEGKRKVEAEWPIFRIHHKRSRYIYDLYFKRKVISKELYNYCIKEKIADANLIAKWKKQGYENLCCLR… |
| G4TH87 | 2-79 | None |
| C1GF49 | 1-113 | None |
| A0A5N5I7N4 | 417-546 | None |
| A0A7S1FHT8 | 16-127 | None |
| A0A177V2V2 | 537-680 | None |
| A0A835NEB2 | 34-119 | None |
| A0A368G3A8 | 116-258 | None |
| A0A6U4NMS9 | 12-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.