DPCstruct | MC2865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 246 ± 28 aa |
| Standard deviation of domain lengths | 28.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8GHH3 | 257-495 | FCKAMSKLPLTALARLSKLWSTYDLPHIRRMMETFQQLITFTVVSNEYDTENLVNDNETVVAATQCLKIIFYASILGGEVDQEHNEE… |
| A0A183PNK7 | 4-256 | INRAVTWLPNTIQVMLCRAWANSVHTPLANCTEPPNPEQTNLWCLQKILLHHITLRCLTTDHGLPNEDKQICEAALVLRIVYYASLL… |
| A0A3Q0J135 | 337-589 | None |
| A0A0N4VLT9 | 365-611 | None |
| A0A3P7P6L6 | 1-292 | None |
| A0A0B2US33 | 726-997 | None |
| U4UBY8 | 2-195 | None |
| A0A0R3TAS9 | 140-420 | None |
| A0A5B7D374 | 394-632 | None |
| A0A819GXK1 | 229-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.