DPCstruct | MC28646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9WKK0 | 77-201 | SASPAANPSANPSASPAANPSASPSAKLAPVLKPKLALASKVAPSPTVSPSANPEAYNRAIDIAMGASTISKSAVSRDDWKLVANSW… |
| A0A0P7ZME7 | 1-76 | MPSYPFRDAVNQAIKASDLTQTAQTAEEWQEVVDAWNAAITGMEDVPESHEQSDLARQKALEYRQNLNYAQEQLAV |
| A0A7C9TZR3 | 43-166 | None |
| A0A1Z4I4T0 | 283-379 | None |
| A0A7T5E195 | 8-116 | None |
| K9F484 | 171-270 | None |
| A0A6P0QGM1 | 52-170 | None |
| A0A6P0QQA9 | 75-184 | None |
| A0A0F5YB56 | 55-138 | None |
| A0A1U7J0R2 | 16-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.