DPCstruct | MC2864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 140 ± 33 aa |
| Standard deviation of domain lengths | 32.86 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484BXP5 | 9-101 | ERCHIRVIDTFGTEPAYNHEEYATRHGYRTNWGYWNLHGQQYMTMFPHTPDNSFMGFVAEELNETERLNIQRNKVNNMAVVYGKEAS… |
| A0A183PFM8 | 11-99 | MMLPRTPLCKFRILDTFGTEALYNRKKELWSGLHLNLQQFYTFFPHSPDNTFLGFVAEILPPKSKFSHQSSSKPVALVYGKEAYMWS… |
| A0A4W3I3C3 | 142-294 | None |
| S4RE96 | 138-319 | None |
| A0A834ASC7 | 2-106 | None |
| A0A3P6QVN6 | 882-1042 | None |
| A0A1I8HYR8 | 126-297 | None |
| H3AJR5 | 191-356 | None |
| A0A5J4P1I8 | 19-106 | None |
| A0A6F9C8Q1 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.