DPCstruct | MC28639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8NU97 | 74-172 | GVLNGVDYTAWNPAKDELIAANYSEEDLSGKQVCKQDLLEVFALPHEHLRRPVIGIVSRFVDQKGFDLIAEQAHELMKEDLVLVVLG… |
| A0A1D6HXN9 | 104-193 | IGIVNGMDVYEWDPSTDKYISVKYDATTVTEARALNKESLQAEVGLPVDSSIPVIVFVGRLEEQKGSDILIAAIPEFVGENVQIIVL… |
| A0A1U8NY04 | 134-221 | None |
| A0A445BSC4 | 400-489 | None |
| A0A2T7DKJ5 | 409-496 | None |
| A0A485CMH1 | 243-344 | None |
| A0A2I0WXT2 | 380-461 | None |
| S9SB51 | 164-249 | None |
| A0A7J9H8W1 | 43-134 | None |
| A0A0A9DBJ1 | 145-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.