DPCstruct | MC28638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 66 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 66.20 |
| Pfam Score | 73.61 |
| Assigned Pfam label(s) | CL0677- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2ETQ4 | 484-539 | MNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQLADEKHWDD |
| A0A5D2B2E4 | 1-66 | MNVSEDESQLSAIARQGSGSACRSLFGGYVKWIMGKEDDGSDSLAVQLVDEKHWEDLFIIIVLVQR |
| A0A444XUN0 | 146-201 | None |
| A0A2T6ZKZ3 | 44-110 | None |
| A0A453SGB1 | 1-57 | None |
| A0A498MM36 | 428-500 | None |
| A0A261XV01 | 140-194 | None |
| A0A6P5U197 | 44-96 | None |
| A0A2P2J099 | 1-55 | None |
| A0A5J5PRM1 | 4-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.