DPCstruct | MC28635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 133 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372Q9F8 | 50-172 | LERLAEELGLDFEKNKDNLKKFYDFAGPNFSWPFKLNIYDRREIFDYIIDPRWEVGEEMANNTIAYYRFIEAGAFDSSKGTHVLIIN… |
| A0A397TVW4 | 1-125 | MPGQAQRFLAHTNKNFRWPISMPEYIRRGTFMHITDDSYKEFGLEVGFNYLFFYNALDNNEFAEHKNEWVTVHKQRVVEYGQRYDDD… |
| A0A397UGJ5 | 16-150 | None |
| A0A397JEL5 | 26-183 | None |
| A0A397JGS7 | 31-167 | None |
| A0A433DJG9 | 36-184 | None |
| A0A433QBV7 | 125-270 | None |
| A0A397S5E3 | 49-209 | None |
| A0A397S8S1 | 65-201 | None |
| U9U0S8 | 77-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.