DPCstruct | MC28634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 173 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397I7K1 | 652-805 | KRLEILEKEKEIILKEMMRGNEVEKSEWGRKHHDNMSIYDDEYYIETQARIREKKRKRAFARQENWAENYEIPNLELFKDFSAWIAG… |
| A0A397TLV6 | 1-161 | MSTIITTKLSTIFPQKSLSYFFIFTQQYATKYKTYYKNERFHKPYDNIGKGNPPIRPKQPLGPDGKNADMRYKEGKNRRYKEYFVNN… |
| U9UAG5 | 1-163 | None |
| A0A397U227 | 1-221 | None |
| A0A397UUF9 | 10-179 | None |
| A0A397HWN3 | 285-451 | None |
| A0A397W6T8 | 14-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.