DPCstruct | MC28631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 186 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2TQ37 | 8-202 | GHKYPGDDTRPTSKKELAGWYCYGWAAEVFTVCAMGSFLPITLEQMARDRGVLLSDKTTPCSASWRVTSDLFTSAASSPSRPSSPKT… |
| A0A2C5XBL4 | 10-203 | SEEDPLASPALRYPGEDVRPTSSKEISGWYMYAFASEVYVICGISSFIPILLETLSRENGHLLHHPDRPCPASHDRLSSSPPDPTPA… |
| A0A0E9NJY3 | 521-723 | None |
| A0A545A4E4 | 47-246 | None |
| A0A1L9N683 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.